Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120
  1. Avatar for FishKAA 81. FishKAA Lv 1 9 pts. 9,091
  2. Avatar for monkry 82. monkry Lv 1 9 pts. 9,090
  3. Avatar for joaniegirl 83. joaniegirl Lv 1 9 pts. 9,089
  4. Avatar for Bushman 84. Bushman Lv 1 8 pts. 9,088
  5. Avatar for gurch 85. gurch Lv 1 8 pts. 9,081
  6. Avatar for WBarme1234 86. WBarme1234 Lv 1 8 pts. 9,080
  7. Avatar for mitarcher 87. mitarcher Lv 1 8 pts. 9,074
  8. Avatar for alcor29 88. alcor29 Lv 1 7 pts. 9,069
  9. Avatar for Deleted player 89. Deleted player pts. 9,064
  10. Avatar for stomjoh 90. stomjoh Lv 1 7 pts. 9,063

Comments