Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,701
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,691
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,645
  4. Avatar for Void Crushers 4. Void Crushers 41 pts. 9,644
  5. Avatar for Go Science 5. Go Science 29 pts. 9,642
  6. Avatar for Contenders 6. Contenders 20 pts. 9,609
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,536
  8. Avatar for Deleted group 8. Deleted group pts. 9,531
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,248
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,227
  1. Avatar for manu8170 201. manu8170 Lv 1 1 pt. 7,419
  2. Avatar for 01010011111 202. 01010011111 Lv 1 1 pt. 7,406
  3. Avatar for Apolloid 203. Apolloid Lv 1 1 pt. 7,398
  4. Avatar for chrisdegray0423 204. chrisdegray0423 Lv 1 1 pt. 7,345
  5. Avatar for Jaco van As 205. Jaco van As Lv 1 1 pt. 7,326
  6. Avatar for joshtheimpaler 206. joshtheimpaler Lv 1 1 pt. 7,298
  7. Avatar for katiekt94 207. katiekt94 Lv 1 1 pt. 7,229
  8. Avatar for Voltozan 208. Voltozan Lv 1 1 pt. 7,221
  9. Avatar for AINHOALARREATEGUI 209. AINHOALARREATEGUI Lv 1 1 pt. 7,217
  10. Avatar for jbmkfm125 210. jbmkfm125 Lv 1 1 pt. 7,174

Comments