Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,701
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,691
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,645
  4. Avatar for Void Crushers 4. Void Crushers 41 pts. 9,644
  5. Avatar for Go Science 5. Go Science 29 pts. 9,642
  6. Avatar for Contenders 6. Contenders 20 pts. 9,609
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,536
  8. Avatar for Deleted group 8. Deleted group pts. 9,531
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,248
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,227
  1. Avatar for Aricot 211. Aricot Lv 1 1 pt. 7,159
  2. Avatar for TheoLivai 212. TheoLivai Lv 1 1 pt. 7,128
  3. Avatar for andrew.peloquin 213. andrew.peloquin Lv 1 1 pt. 7,063
  4. Avatar for kcyan 214. kcyan Lv 1 1 pt. 7,037
  5. Avatar for Loshario 215. Loshario Lv 1 1 pt. 6,967
  6. Avatar for glambert 216. glambert Lv 1 1 pt. 6,562
  7. Avatar for Total-Destroy 217. Total-Destroy Lv 1 1 pt. 6,318
  8. Avatar for xplocast1 218. xplocast1 Lv 1 1 pt. 6,260
  9. Avatar for tdksf9 219. tdksf9 Lv 1 1 pt. 5,963
  10. Avatar for gcm24 220. gcm24 Lv 1 1 pt. 1,278

Comments