Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups


  1. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,413
  2. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,370
  3. Avatar for freefolder 14. freefolder 1 pt. 7,874
  4. Avatar for HTCMS Mr Cardo Class 15. HTCMS Mr Cardo Class 1 pt. 6,609
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 4,372

  1. Avatar for Mike Cassidy 61. Mike Cassidy Lv 1 10 pts. 8,995
  2. Avatar for heather-1 62. heather-1 Lv 1 10 pts. 8,988
  3. Avatar for gurch 63. gurch Lv 1 9 pts. 8,972
  4. Avatar for isaksson 64. isaksson Lv 1 9 pts. 8,962
  5. Avatar for Keresto 65. Keresto Lv 1 8 pts. 8,944
  6. Avatar for diamonddays 66. diamonddays Lv 1 8 pts. 8,936
  7. Avatar for grogar7 67. grogar7 Lv 1 7 pts. 8,918
  8. Avatar for uihcv 68. uihcv Lv 1 7 pts. 8,915
  9. Avatar for Steven Pletsch 69. Steven Pletsch Lv 1 7 pts. 8,897
  10. Avatar for YeshuaLives 70. YeshuaLives Lv 1 6 pts. 8,876

Comments