Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups


  1. Avatar for Contenders 100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772

  1. Avatar for Mike Cassidy 61. Mike Cassidy Lv 1 10 pts. 8,995
  2. Avatar for heather-1 62. heather-1 Lv 1 10 pts. 8,988
  3. Avatar for gurch 63. gurch Lv 1 9 pts. 8,972
  4. Avatar for isaksson 64. isaksson Lv 1 9 pts. 8,962
  5. Avatar for Keresto 65. Keresto Lv 1 8 pts. 8,944
  6. Avatar for diamonddays 66. diamonddays Lv 1 8 pts. 8,936
  7. Avatar for grogar7 67. grogar7 Lv 1 7 pts. 8,918
  8. Avatar for uihcv 68. uihcv Lv 1 7 pts. 8,915
  9. Avatar for Steven Pletsch 69. Steven Pletsch Lv 1 7 pts. 8,897
  10. Avatar for YeshuaLives 70. YeshuaLives Lv 1 6 pts. 8,876

Comments