Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772
  1. Avatar for momadoc 121. momadoc Lv 1 1 pt. 8,089
  2. Avatar for Jim Fraser 122. Jim Fraser Lv 1 1 pt. 8,071
  3. Avatar for donckypoop 123. donckypoop Lv 1 1 pt. 8,058
  4. Avatar for tweak64 124. tweak64 Lv 1 1 pt. 8,054
  5. Avatar for 341441 125. 341441 Lv 1 1 pt. 7,960
  6. Avatar for rezaefar 126. rezaefar Lv 1 1 pt. 7,954
  7. Avatar for katling 127. katling Lv 1 1 pt. 7,950
  8. Avatar for feand 128. feand Lv 1 1 pt. 7,915
  9. Avatar for Imeturoran 129. Imeturoran Lv 1 1 pt. 7,874
  10. Avatar for ZiiONIC 130. ZiiONIC Lv 1 1 pt. 7,808

Comments