Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772
  1. Avatar for martin.szew 101. martin.szew Lv 1 1 pt. 8,434
  2. Avatar for ViJay7019 102. ViJay7019 Lv 1 1 pt. 8,427
  3. Avatar for doctaven 103. doctaven Lv 1 1 pt. 8,413
  4. Avatar for JUMELLE54 104. JUMELLE54 Lv 1 1 pt. 8,400
  5. Avatar for johngran 105. johngran Lv 1 1 pt. 8,389
  6. Avatar for mitarcher 106. mitarcher Lv 1 1 pt. 8,379
  7. Avatar for harvardman 107. harvardman Lv 1 1 pt. 8,377
  8. Avatar for asperger1993 108. asperger1993 Lv 1 1 pt. 8,372
  9. Avatar for Bushman 109. Bushman Lv 1 1 pt. 8,370
  10. Avatar for FishKAA 110. FishKAA Lv 1 1 pt. 8,348

Comments