Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772
  1. Avatar for MicElephant 91. MicElephant Lv 1 2 pts. 8,574
  2. Avatar for Arne Heessels 92. Arne Heessels Lv 1 2 pts. 8,573
  3. Avatar for Iron pet 93. Iron pet Lv 1 2 pts. 8,547
  4. Avatar for Cerzax 94. Cerzax Lv 1 2 pts. 8,540
  5. Avatar for tallguy-13088 95. tallguy-13088 Lv 1 2 pts. 8,512
  6. Avatar for guineapig 96. guineapig Lv 1 2 pts. 8,491
  7. Avatar for joaniegirl 97. joaniegirl Lv 1 2 pts. 8,487
  8. Avatar for karost 98. karost Lv 1 1 pt. 8,466
  9. Avatar for dbuske 99. dbuske Lv 1 1 pt. 8,452
  10. Avatar for SaraL 100. SaraL Lv 1 1 pt. 8,445

Comments