Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069

  1. Avatar for Jim Fraser 51. Jim Fraser Lv 1 22 pts. 9,077
  2. Avatar for Crossed Sticks 52. Crossed Sticks Lv 1 21 pts. 9,072
  3. Avatar for WBarme1234 53. WBarme1234 Lv 1 20 pts. 9,068
  4. Avatar for gdnskye 54. gdnskye Lv 1 19 pts. 9,056
  5. Avatar for jamiexq 55. jamiexq Lv 1 19 pts. 9,054
  6. Avatar for caglar 56. caglar Lv 1 18 pts. 9,039
  7. Avatar for drumpeter18yrs9yrs 57. drumpeter18yrs9yrs Lv 1 17 pts. 9,033
  8. Avatar for hansvandenhof 58. hansvandenhof Lv 1 17 pts. 9,028
  9. Avatar for Glen B 59. Glen B Lv 1 16 pts. 9,022
  10. Avatar for diamonddays 60. diamonddays Lv 1 16 pts. 9,020

Comments