Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,659

  1. Avatar for Deleted player 91. Deleted player pts. 8,809
  2. Avatar for AeonFluff 92. AeonFluff Lv 1 5 pts. 8,804
  3. Avatar for rezaefar 93. rezaefar Lv 1 5 pts. 8,788
  4. Avatar for Merf 94. Merf Lv 1 5 pts. 8,734
  5. Avatar for cobaltteal 95. cobaltteal Lv 1 4 pts. 8,713
  6. Avatar for mitarcher 96. mitarcher Lv 1 4 pts. 8,674
  7. Avatar for 55SciOne 97. 55SciOne Lv 1 4 pts. 8,645
  8. Avatar for Psych0Active 98. Psych0Active Lv 1 4 pts. 8,597
  9. Avatar for harvardman 99. harvardman Lv 1 4 pts. 8,592
  10. Avatar for weitzen 100. weitzen Lv 1 3 pts. 8,583

Comments