Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,659

  1. Avatar for cherry39 101. cherry39 Lv 1 3 pts. 8,553
  2. Avatar for dssb 102. dssb Lv 1 3 pts. 8,552
  3. Avatar for lupussapien 103. lupussapien Lv 1 3 pts. 8,545
  4. Avatar for manu8170 104. manu8170 Lv 1 3 pts. 8,537
  5. Avatar for rakei 105. rakei Lv 1 3 pts. 8,527
  6. Avatar for Paulo Roque 106. Paulo Roque Lv 1 3 pts. 8,506
  7. Avatar for JUMELLE54 107. JUMELLE54 Lv 1 3 pts. 8,476
  8. Avatar for leannerikicheever 108. leannerikicheever Lv 1 2 pts. 8,463
  9. Avatar for Reldas 109. Reldas Lv 1 2 pts. 8,421
  10. Avatar for Bushman 110. Bushman Lv 1 2 pts. 8,384

Comments