Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,659

  1. Avatar for gu14016 111. gu14016 Lv 1 2 pts. 8,316
  2. Avatar for pandapharmd 112. pandapharmd Lv 1 2 pts. 8,286
  3. Avatar for Fuchsritter 113. Fuchsritter Lv 1 2 pts. 8,265
  4. Avatar for jebbiek 114. jebbiek Lv 1 2 pts. 8,215
  5. Avatar for SouperGenious 115. SouperGenious Lv 1 2 pts. 8,174
  6. Avatar for Superphosphate 116. Superphosphate Lv 1 2 pts. 8,162
  7. Avatar for Iron pet 117. Iron pet Lv 1 2 pts. 8,148
  8. Avatar for momadoc 118. momadoc Lv 1 2 pts. 8,143
  9. Avatar for joaniegirl 119. joaniegirl Lv 1 1 pt. 8,133
  10. Avatar for kvasirthewise 120. kvasirthewise Lv 1 1 pt. 8,128

Comments