Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary

Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,659
  1. Avatar for nagistick 121. nagistick Lv 1 1 pt. 8,120
  2. Avatar for senor pit 122. senor pit Lv 1 1 pt. 8,072
  3. Avatar for Imeturoran 123. Imeturoran Lv 1 1 pt. 8,021
  4. Avatar for freethought78 124. freethought78 Lv 1 1 pt. 8,020
  5. Avatar for FishKAA 125. FishKAA Lv 1 1 pt. 8,020
  6. Avatar for rinze 126. rinze Lv 1 1 pt. 8,012
  7. Avatar for 1210115146 127. 1210115146 Lv 1 1 pt. 7,996
  8. Avatar for DScott 128. DScott Lv 1 1 pt. 7,984
  9. Avatar for 64SciOne 129. 64SciOne Lv 1 1 pt. 7,921
  10. Avatar for muk31 130. muk31 Lv 1 1 pt. 7,916

Comments