Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,659

  1. Avatar for TuJu 131. TuJu Lv 1 1 pt. 7,910
  2. Avatar for justjustin 132. justjustin Lv 1 1 pt. 7,882
  3. Avatar for leehaggis 133. leehaggis Lv 1 1 pt. 7,807
  4. Avatar for Cerzax 134. Cerzax Lv 1 1 pt. 7,800
  5. Avatar for Casmiera3384 135. Casmiera3384 Lv 1 1 pt. 7,759
  6. Avatar for matosfran 136. matosfran Lv 1 1 pt. 7,706
  7. Avatar for Lilyam 137. Lilyam Lv 1 1 pt. 7,694
  8. Avatar for jarbolol15 138. jarbolol15 Lv 1 1 pt. 7,689
  9. Avatar for Kiwegapa 139. Kiwegapa Lv 1 1 pt. 7,677
  10. Avatar for didemkucuk 140. didemkucuk Lv 1 1 pt. 7,669

Comments