Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,659

  1. Avatar for Dantoto 141. Dantoto Lv 1 1 pt. 7,667
  2. Avatar for broodtrommel102 142. broodtrommel102 Lv 1 1 pt. 7,636
  3. Avatar for roman madala 143. roman madala Lv 1 1 pt. 7,625
  4. Avatar for LazyLysosome 144. LazyLysosome Lv 1 1 pt. 7,617
  5. Avatar for hajtogato 145. hajtogato Lv 1 1 pt. 7,616
  6. Avatar for elSzymo 146. elSzymo Lv 1 1 pt. 7,602
  7. Avatar for parsnip 147. parsnip Lv 1 1 pt. 7,590
  8. Avatar for yaksari 148. yaksari Lv 1 1 pt. 7,589
  9. Avatar for gu14015 149. gu14015 Lv 1 1 pt. 7,586
  10. Avatar for trentis1 150. trentis1 Lv 1 1 pt. 7,576

Comments