Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary

Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,659
  1. Avatar for mattspamp 151. mattspamp Lv 1 1 pt. 7,556
  2. Avatar for tshock 152. tshock Lv 1 1 pt. 7,550
  3. Avatar for Blacksteel99 153. Blacksteel99 Lv 1 1 pt. 7,549
  4. Avatar for 18danielle18 154. 18danielle18 Lv 1 1 pt. 7,536
  5. Avatar for CassandraRobinson 155. CassandraRobinson Lv 1 1 pt. 7,513
  6. Avatar for Ciccillo 156. Ciccillo Lv 1 1 pt. 7,495
  7. Avatar for JCBio162 157. JCBio162 Lv 1 1 pt. 7,495
  8. Avatar for 123456969lolayylmao 158. 123456969lolayylmao Lv 1 1 pt. 7,490
  9. Avatar for anne123789 159. anne123789 Lv 1 1 pt. 7,485
  10. Avatar for ostrowsisabelr 160. ostrowsisabelr Lv 1 1 pt. 7,475

Comments