Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,659

  1. Avatar for gu14001 161. gu14001 Lv 1 1 pt. 7,473
  2. Avatar for gedertrosemary 162. gedertrosemary Lv 1 1 pt. 7,466
  3. Avatar for dbradley117 163. dbradley117 Lv 1 1 pt. 7,444
  4. Avatar for 01010011111 164. 01010011111 Lv 1 1 pt. 7,440
  5. Avatar for Ephirasp Spices 165. Ephirasp Spices Lv 1 1 pt. 7,440
  6. Avatar for aspadistra 166. aspadistra Lv 1 1 pt. 7,438
  7. Avatar for Petooor 167. Petooor Lv 1 1 pt. 7,426
  8. Avatar for paigelukasik 168. paigelukasik Lv 1 1 pt. 7,418
  9. Avatar for Radionactiveman 169. Radionactiveman Lv 1 1 pt. 7,405
  10. Avatar for zdykes 170. zdykes Lv 1 1 pt. 7,395

Comments