Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,659

  1. Avatar for larry25427 171. larry25427 Lv 1 1 pt. 7,394
  2. Avatar for tweak64 172. tweak64 Lv 1 1 pt. 7,377
  3. Avatar for katiekt94 173. katiekt94 Lv 1 1 pt. 7,377
  4. Avatar for Dunc-Daddy 174. Dunc-Daddy Lv 1 1 pt. 7,373
  5. Avatar for khendarg 175. khendarg Lv 1 1 pt. 7,341
  6. Avatar for lamoille 176. lamoille Lv 1 1 pt. 7,285
  7. Avatar for mackenzieee57 177. mackenzieee57 Lv 1 1 pt. 7,270
  8. Avatar for Deleted player 178. Deleted player pts. 7,250
  9. Avatar for jeacom 179. jeacom Lv 1 1 pt. 7,246
  10. Avatar for ivalnic 180. ivalnic Lv 1 1 pt. 7,202

Comments