Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,659

  1. Avatar for Hdmedik 181. Hdmedik Lv 1 1 pt. 7,145
  2. Avatar for fero 182. fero Lv 1 1 pt. 7,073
  3. Avatar for aagosto1 183. aagosto1 Lv 1 1 pt. 6,905
  4. Avatar for wjvanpatten 184. wjvanpatten Lv 1 1 pt. 6,644
  5. Avatar for mcclurekatherie 185. mcclurekatherie Lv 1 1 pt. 6,633
  6. Avatar for jaynovan15 186. jaynovan15 Lv 1 1 pt. 6,612
  7. Avatar for tokens 187. tokens Lv 1 1 pt. 6,399
  8. Avatar for BCzechowski 188. BCzechowski Lv 1 1 pt. 5,785
  9. Avatar for jflat06 189. jflat06 Lv 1 1 pt. 5,659
  10. Avatar for jwu1234567890 190. jwu1234567890 Lv 1 1 pt. 5,327

Comments