Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary

Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,659
  1. Avatar for Skippysk8s 31. Skippysk8s Lv 1 44 pts. 9,958
  2. Avatar for tarimo 32. tarimo Lv 1 43 pts. 9,951
  3. Avatar for eusair 33. eusair Lv 1 42 pts. 9,949
  4. Avatar for toshiue 34. toshiue Lv 1 40 pts. 9,943
  5. Avatar for jermainiac 35. jermainiac Lv 1 39 pts. 9,926
  6. Avatar for georg137 36. georg137 Lv 1 38 pts. 9,914
  7. Avatar for pmdpmd 37. pmdpmd Lv 1 37 pts. 9,900
  8. Avatar for dbuske 38. dbuske Lv 1 36 pts. 9,898
  9. Avatar for jobo0502 39. jobo0502 Lv 1 35 pts. 9,890
  10. Avatar for Museka 40. Museka Lv 1 33 pts. 9,860

Comments