Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary

Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,659
  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 32 pts. 9,858
  2. Avatar for Deleted player 42. Deleted player pts. 9,821
  3. Avatar for shettler 43. shettler Lv 1 30 pts. 9,816
  4. Avatar for randomlil 44. randomlil Lv 1 29 pts. 9,809
  5. Avatar for pfirth 45. pfirth Lv 1 29 pts. 9,793
  6. Avatar for jfryk 46. jfryk Lv 1 28 pts. 9,777
  7. Avatar for JayD7217 47. JayD7217 Lv 1 27 pts. 9,767
  8. Avatar for phi16 48. phi16 Lv 1 26 pts. 9,763
  9. Avatar for Norrjane 49. Norrjane Lv 1 25 pts. 9,738
  10. Avatar for sheerbliss 50. sheerbliss Lv 1 24 pts. 9,733

Comments