Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary

Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,659
  1. Avatar for SaraL 51. SaraL Lv 1 23 pts. 9,730
  2. Avatar for NinjaGreg 52. NinjaGreg Lv 1 23 pts. 9,724
  3. Avatar for Vinara 53. Vinara Lv 1 22 pts. 9,714
  4. Avatar for Glen B 54. Glen B Lv 1 21 pts. 9,711
  5. Avatar for drumpeter18yrs9yrs 55. drumpeter18yrs9yrs Lv 1 20 pts. 9,690
  6. Avatar for Anfinsen_slept_here 56. Anfinsen_slept_here Lv 1 20 pts. 9,649
  7. Avatar for hansvandenhof 57. hansvandenhof Lv 1 19 pts. 9,648
  8. Avatar for MicElephant 58. MicElephant Lv 1 18 pts. 9,644
  9. Avatar for ManVsYard 59. ManVsYard Lv 1 18 pts. 9,641
  10. Avatar for Deleted player 60. Deleted player pts. 9,636

Comments