Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary

Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,659
  1. Avatar for stomjoh 61. stomjoh Lv 1 17 pts. 9,608
  2. Avatar for isaksson 62. isaksson Lv 1 16 pts. 9,588
  3. Avatar for diamonddays 63. diamonddays Lv 1 15 pts. 9,539
  4. Avatar for alwen 64. alwen Lv 1 15 pts. 9,527
  5. Avatar for WBarme1234 65. WBarme1234 Lv 1 14 pts. 9,504
  6. Avatar for alcor29 66. alcor29 Lv 1 14 pts. 9,471
  7. Avatar for deLaCeiba 67. deLaCeiba Lv 1 13 pts. 9,463
  8. Avatar for guineapig 68. guineapig Lv 1 13 pts. 9,457
  9. Avatar for Crossed Sticks 69. Crossed Sticks Lv 1 12 pts. 9,446
  10. Avatar for pellegrinipaol 70. pellegrinipaol Lv 1 12 pts. 9,419

Comments