Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary

Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,659
  1. Avatar for caglar 71. caglar Lv 1 11 pts. 9,366
  2. Avatar for Mr_Jolty 72. Mr_Jolty Lv 1 11 pts. 9,360
  3. Avatar for Formula350 73. Formula350 Lv 1 11 pts. 9,359
  4. Avatar for O Seki To 74. O Seki To Lv 1 10 pts. 9,351
  5. Avatar for Fog Darts 75. Fog Darts Lv 1 10 pts. 9,247
  6. Avatar for uihcv 76. uihcv Lv 1 9 pts. 9,224
  7. Avatar for dizzywings 77. dizzywings Lv 1 9 pts. 9,212
  8. Avatar for fishercat 78. fishercat Lv 1 9 pts. 9,179
  9. Avatar for Jim Fraser 79. Jim Fraser Lv 1 8 pts. 9,171
  10. Avatar for ViJay7019 80. ViJay7019 Lv 1 8 pts. 9,131

Comments