Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary

Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 5,659
  1. Avatar for fryguy 81. fryguy Lv 1 8 pts. 9,105
  2. Avatar for Ikuso 82. Ikuso Lv 1 7 pts. 9,105
  3. Avatar for johngran 83. johngran Lv 1 7 pts. 9,041
  4. Avatar for altaris 84. altaris Lv 1 7 pts. 9,032
  5. Avatar for eromana 85. eromana Lv 1 7 pts. 9,006
  6. Avatar for sgandlur 86. sgandlur Lv 1 6 pts. 8,968
  7. Avatar for SKSbell 87. SKSbell Lv 1 6 pts. 8,966
  8. Avatar for katling 88. katling Lv 1 6 pts. 8,965
  9. Avatar for altejoh 89. altejoh Lv 1 6 pts. 8,938
  10. Avatar for Arne Heessels 90. Arne Heessels Lv 1 5 pts. 8,810

Comments