Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,841
  2. Avatar for Go Science 2. Go Science 80 pts. 9,841
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,831
  4. Avatar for Contenders 4. Contenders 49 pts. 9,784
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,688
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,610
  7. Avatar for xkcd 7. xkcd 21 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,484
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,385
  10. Avatar for Kotocycle 10. Kotocycle 8 pts. 9,248

  1. Avatar for Threeoak 41. Threeoak Lv 1 32 pts. 9,424
  2. Avatar for Keresto 42. Keresto Lv 1 31 pts. 9,423
  3. Avatar for shettler 43. shettler Lv 1 30 pts. 9,422
  4. Avatar for mimi 44. mimi Lv 1 29 pts. 9,416
  5. Avatar for Glen B 45. Glen B Lv 1 28 pts. 9,395
  6. Avatar for tarimo 46. tarimo Lv 1 27 pts. 9,393
  7. Avatar for TomTaylor 47. TomTaylor Lv 1 26 pts. 9,386
  8. Avatar for deLaCeiba 48. deLaCeiba Lv 1 25 pts. 9,385
  9. Avatar for kabubi 49. kabubi Lv 1 24 pts. 9,379
  10. Avatar for pvc78 50. pvc78 Lv 1 24 pts. 9,377

Comments