Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 9,214
  2. Avatar for Deleted group 12. Deleted group pts. 8,938
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 8,823
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 2 pts. 8,634
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,215
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,789
  7. Avatar for SciOne2017 17. SciOne2017 1 pt. 7,633
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,055
  9. Avatar for Deleted group 19. Deleted group pts. 6,857
  10. Avatar for Freedom Folders 20. Freedom Folders 1 pt. 5,464

  1. Avatar for Bautho 81. Bautho Lv 1 7 pts. 8,982
  2. Avatar for TastyMunchies 83. TastyMunchies Lv 1 7 pts. 8,981
  3. Avatar for Fog Darts 84. Fog Darts Lv 1 7 pts. 8,979
  4. Avatar for Bushman 85. Bushman Lv 1 6 pts. 8,961
  5. Avatar for philcalhoun 86. philcalhoun Lv 1 6 pts. 8,950
  6. Avatar for freethought78 87. freethought78 Lv 1 6 pts. 8,938
  7. Avatar for cbwest 88. cbwest Lv 1 5 pts. 8,921
  8. Avatar for froggs554 89. froggs554 Lv 1 5 pts. 8,907
  9. Avatar for heather-1 90. heather-1 Lv 1 5 pts. 8,896

Comments