Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,841
  2. Avatar for Go Science 2. Go Science 80 pts. 9,841
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,831
  4. Avatar for Contenders 4. Contenders 49 pts. 9,784
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,688
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,610
  7. Avatar for xkcd 7. xkcd 21 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,484
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,385
  10. Avatar for Kotocycle 10. Kotocycle 8 pts. 9,248
  1. Avatar for Bautho 81. Bautho Lv 1 7 pts. 8,982
  2. Avatar for Anfinsen_slept_here 82. Anfinsen_slept_here Lv 1 7 pts. 8,982
  3. Avatar for TastyMunchies 83. TastyMunchies Lv 1 7 pts. 8,981
  4. Avatar for Fog Darts 84. Fog Darts Lv 1 7 pts. 8,979
  5. Avatar for Bushman 85. Bushman Lv 1 6 pts. 8,961
  6. Avatar for philcalhoun 86. philcalhoun Lv 1 6 pts. 8,950
  7. Avatar for freethought78 87. freethought78 Lv 1 6 pts. 8,938
  8. Avatar for cbwest 88. cbwest Lv 1 5 pts. 8,921
  9. Avatar for froggs554 89. froggs554 Lv 1 5 pts. 8,907
  10. Avatar for heather-1 90. heather-1 Lv 1 5 pts. 8,896

Comments