Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for Glucoast 171. Glucoast Lv 1 1 pt. 5,565
  2. Avatar for umalns 172. umalns Lv 1 1 pt. 5,539
  3. Avatar for 123456969lolayylmao 173. 123456969lolayylmao Lv 1 1 pt. 5,485
  4. Avatar for weurhartdezirez 174. weurhartdezirez Lv 1 1 pt. 5,464
  5. Avatar for larry25427 175. larry25427 Lv 1 1 pt. 5,456
  6. Avatar for Sci1T2 176. Sci1T2 Lv 1 1 pt. 5,449
  7. Avatar for gu14001 177. gu14001 Lv 1 1 pt. 5,444
  8. Avatar for wjy1 178. wjy1 Lv 1 1 pt. 5,440
  9. Avatar for Niccudrat 179. Niccudrat Lv 1 1 pt. 5,380
  10. Avatar for a.rcher 180. a.rcher Lv 1 1 pt. 5,305

Comments