Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,841
  2. Avatar for Go Science 2. Go Science 80 pts. 9,841
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,831
  4. Avatar for Contenders 4. Contenders 49 pts. 9,784
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,688
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,610
  7. Avatar for xkcd 7. xkcd 21 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,484
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,385
  10. Avatar for Kotocycle 10. Kotocycle 8 pts. 9,248
  1. Avatar for Glucoast 171. Glucoast Lv 1 1 pt. 5,565
  2. Avatar for umalns 172. umalns Lv 1 1 pt. 5,539
  3. Avatar for 123456969lolayylmao 173. 123456969lolayylmao Lv 1 1 pt. 5,485
  4. Avatar for weurhartdezirez 174. weurhartdezirez Lv 1 1 pt. 5,464
  5. Avatar for larry25427 175. larry25427 Lv 1 1 pt. 5,456
  6. Avatar for Sci1T2 176. Sci1T2 Lv 1 1 pt. 5,449
  7. Avatar for gu14001 177. gu14001 Lv 1 1 pt. 5,444
  8. Avatar for wjy1 178. wjy1 Lv 1 1 pt. 5,440
  9. Avatar for Niccudrat 179. Niccudrat Lv 1 1 pt. 5,380
  10. Avatar for a.rcher 180. a.rcher Lv 1 1 pt. 5,305

Comments