Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for Bautho 81. Bautho Lv 1 7 pts. 8,982
  2. Avatar for Anfinsen_slept_here 82. Anfinsen_slept_here Lv 1 7 pts. 8,982
  3. Avatar for TastyMunchies 83. TastyMunchies Lv 1 7 pts. 8,981
  4. Avatar for Fog Darts 84. Fog Darts Lv 1 7 pts. 8,979
  5. Avatar for Bushman 85. Bushman Lv 1 6 pts. 8,961
  6. Avatar for philcalhoun 86. philcalhoun Lv 1 6 pts. 8,950
  7. Avatar for freethought78 87. freethought78 Lv 1 6 pts. 8,938
  8. Avatar for cbwest 88. cbwest Lv 1 5 pts. 8,921
  9. Avatar for froggs554 89. froggs554 Lv 1 5 pts. 8,907
  10. Avatar for heather-1 90. heather-1 Lv 1 5 pts. 8,896

Comments