Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,841
  2. Avatar for Go Science 2. Go Science 80 pts. 9,841
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,831
  4. Avatar for Contenders 4. Contenders 49 pts. 9,784
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,688
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,610
  7. Avatar for xkcd 7. xkcd 21 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,484
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,385
  10. Avatar for Kotocycle 10. Kotocycle 8 pts. 9,248

  1. Avatar for toth.matthew 131. toth.matthew Lv 1 1 pt. 8,153
  2. Avatar for SouperGenious 132. SouperGenious Lv 1 1 pt. 8,140
  3. Avatar for folderredlof 133. folderredlof Lv 1 1 pt. 8,122
  4. Avatar for ZiiONIC 134. ZiiONIC Lv 1 1 pt. 8,095
  5. Avatar for GU14110 135. GU14110 Lv 1 1 pt. 8,007
  6. Avatar for trentis1 136. trentis1 Lv 1 1 pt. 7,980
  7. Avatar for sgandlur 137. sgandlur Lv 1 1 pt. 7,930
  8. Avatar for parsnip 138. parsnip Lv 1 1 pt. 7,872
  9. Avatar for IHGreenman 139. IHGreenman Lv 1 1 pt. 7,818
  10. Avatar for lamoille 140. lamoille Lv 1 1 pt. 7,791

Comments