Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 17,650
  2. Avatar for Go Science 2. Go Science 78 pts. 17,627
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 17,344
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 16,932
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 16,653
  6. Avatar for Deleted group 6. Deleted group pts. 16,499
  7. Avatar for Contenders 7. Contenders 17 pts. 16,180
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 15,894
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 15,447
  10. Avatar for xkcd 10. xkcd 6 pts. 14,977
  1. Avatar for emdee314 151. emdee314 Lv 1 1 pt. 9,853
  2. Avatar for DScott 152. DScott Lv 1 1 pt. 9,328
  3. Avatar for Cuddlepaws 153. Cuddlepaws Lv 1 1 pt. 9,212
  4. Avatar for pandapharmd 154. pandapharmd Lv 1 1 pt. 8,793
  5. Avatar for aspadistra 155. aspadistra Lv 1 1 pt. 8,750
  6. Avatar for pielie 156. pielie Lv 1 1 pt. 8,554
  7. Avatar for bobhelmut 157. bobhelmut Lv 1 1 pt. 8,350
  8. Avatar for aschueller 158. aschueller Lv 1 1 pt. 8,324
  9. Avatar for RynVT12 159. RynVT12 Lv 1 1 pt. 8,289
  10. Avatar for Alekhya.vytla 160. Alekhya.vytla Lv 1 1 pt. 8,285

Comments