Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 17,650
  2. Avatar for Go Science 2. Go Science 78 pts. 17,627
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 17,344
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 16,932
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 16,653
  6. Avatar for Deleted group 6. Deleted group pts. 16,499
  7. Avatar for Contenders 7. Contenders 17 pts. 16,180
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 15,894
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 15,447
  10. Avatar for xkcd 10. xkcd 6 pts. 14,977
  1. Avatar for dam_01 121. dam_01 Lv 1 1 pt. 14,057
  2. Avatar for SouperGenious 122. SouperGenious Lv 1 1 pt. 14,054
  3. Avatar for LazyLysosome 123. LazyLysosome Lv 1 1 pt. 14,027
  4. Avatar for mitarcher 124. mitarcher Lv 1 1 pt. 14,026
  5. Avatar for trentis1 125. trentis1 Lv 1 1 pt. 13,917
  6. Avatar for rinze 126. rinze Lv 1 1 pt. 13,757
  7. Avatar for boondog 127. boondog Lv 1 1 pt. 13,729
  8. Avatar for gu14001 128. gu14001 Lv 1 1 pt. 13,669
  9. Avatar for amurdock 129. amurdock Lv 1 1 pt. 13,509
  10. Avatar for tweak64 130. tweak64 Lv 1 1 pt. 13,475

Comments