Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 17,650
  2. Avatar for Go Science 2. Go Science 78 pts. 17,627
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 17,344
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 16,932
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 16,653
  6. Avatar for Deleted group 6. Deleted group pts. 16,499
  7. Avatar for Contenders 7. Contenders 17 pts. 16,180
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 15,894
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 15,447
  10. Avatar for xkcd 10. xkcd 6 pts. 14,977
  1. Avatar for Deleted player 131. Deleted player pts. 13,220
  2. Avatar for ManVsYard 132. ManVsYard Lv 1 1 pt. 13,183
  3. Avatar for froggs554 133. froggs554 Lv 1 1 pt. 13,126
  4. Avatar for Tehnologik1 134. Tehnologik1 Lv 1 1 pt. 13,006
  5. Avatar for xavierhochart 135. xavierhochart Lv 1 1 pt. 12,974
  6. Avatar for pooja chennupati 136. pooja chennupati Lv 1 1 pt. 12,680
  7. Avatar for NotJim99 137. NotJim99 Lv 1 1 pt. 12,622
  8. Avatar for Fatcat560 138. Fatcat560 Lv 1 1 pt. 12,575
  9. Avatar for doctaven 139. doctaven Lv 1 1 pt. 12,410
  10. Avatar for Jumbly 140. Jumbly Lv 1 1 pt. 12,303

Comments