Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 3 pts. 8,561
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,528
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,516
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 1 pt. 8,495
  5. Avatar for SciOne2017 15. SciOne2017 1 pt. 8,386
  6. Avatar for :) 16. :) 1 pt. 8,352
  7. Avatar for BIO257C 17. BIO257C 1 pt. 7,914
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,740
  9. Avatar for Deleted group 19. Deleted group pts. 6,829
  10. Avatar for SFASU_BIOL4356/5356 20. SFASU_BIOL4356/5356 1 pt. 6,441

  1. Avatar for Iron pet 111. Iron pet Lv 1 1 pt. 8,419
  2. Avatar for mitarcher 112. mitarcher Lv 1 1 pt. 8,400
  3. Avatar for Nick_Flamel 113. Nick_Flamel Lv 1 1 pt. 8,397
  4. Avatar for dizzywings 114. dizzywings Lv 1 1 pt. 8,392
  5. Avatar for Cerzax 115. Cerzax Lv 1 1 pt. 8,390
  6. Avatar for 55SciOne 116. 55SciOne Lv 1 1 pt. 8,386
  7. Avatar for pooja chennupati 117. pooja chennupati Lv 1 1 pt. 8,367
  8. Avatar for SouperGenious 118. SouperGenious Lv 1 1 pt. 8,358
  9. Avatar for machinelves 119. machinelves Lv 1 1 pt. 8,352
  10. Avatar for MadCat08 120. MadCat08 Lv 1 1 pt. 8,346

Comments