Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 3 pts. 8,561
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,528
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,516
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 1 pt. 8,495
  5. Avatar for SciOne2017 15. SciOne2017 1 pt. 8,386
  6. Avatar for :) 16. :) 1 pt. 8,352
  7. Avatar for BIO257C 17. BIO257C 1 pt. 7,914
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,740
  9. Avatar for Deleted group 19. Deleted group pts. 6,829
  10. Avatar for SFASU_BIOL4356/5356 20. SFASU_BIOL4356/5356 1 pt. 6,441
  1. Avatar for randomlil 31. randomlil Lv 1 41 pts. 8,992
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 40 pts. 8,991
  3. Avatar for MurloW 33. MurloW Lv 1 39 pts. 8,981
  4. Avatar for diamonddays 34. diamonddays Lv 1 37 pts. 8,980
  5. Avatar for Blipperman 35. Blipperman Lv 1 36 pts. 8,969
  6. Avatar for Vinara 36. Vinara Lv 1 35 pts. 8,963
  7. Avatar for phi16 37. phi16 Lv 1 34 pts. 8,954
  8. Avatar for nicobul 38. nicobul Lv 1 33 pts. 8,950
  9. Avatar for NinjaGreg 39. NinjaGreg Lv 1 32 pts. 8,943
  10. Avatar for YeshuaLives 40. YeshuaLives Lv 1 30 pts. 8,939

Comments