Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 3 pts. 8,561
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,528
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,516
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 1 pt. 8,495
  5. Avatar for SciOne2017 15. SciOne2017 1 pt. 8,386
  6. Avatar for :) 16. :) 1 pt. 8,352
  7. Avatar for BIO257C 17. BIO257C 1 pt. 7,914
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,740
  9. Avatar for Deleted group 19. Deleted group pts. 6,829
  10. Avatar for SFASU_BIOL4356/5356 20. SFASU_BIOL4356/5356 1 pt. 6,441

  1. Avatar for tony46 51. tony46 Lv 1 21 pts. 8,891
  2. Avatar for fryguy 52. fryguy Lv 1 20 pts. 8,868
  3. Avatar for dcrwheeler 53. dcrwheeler Lv 1 19 pts. 8,865
  4. Avatar for smilingone 54. smilingone Lv 1 18 pts. 8,864
  5. Avatar for fishercat 55. fishercat Lv 1 18 pts. 8,855
  6. Avatar for Glen B 56. Glen B Lv 1 17 pts. 8,852
  7. Avatar for jobo0502 57. jobo0502 Lv 1 16 pts. 8,851
  8. Avatar for alwen 58. alwen Lv 1 16 pts. 8,849
  9. Avatar for uihcv 59. uihcv Lv 1 15 pts. 8,849
  10. Avatar for heather-1 60. heather-1 Lv 1 15 pts. 8,845

Comments