Placeholder image of a protein
Icon representing a puzzle

1359: Revisiting Puzzle 93: Spider Toxin

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Go Science 100 pts. 9,543
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,541
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,524
  4. Avatar for Contenders 4. Contenders 43 pts. 9,462
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 9,438
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,391
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,152
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,075
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,057

  1. Avatar for philcalhoun 71. philcalhoun Lv 1 9 pts. 9,052
  2. Avatar for Museka 72. Museka Lv 1 9 pts. 9,050
  3. Avatar for harvardman 73. harvardman Lv 1 9 pts. 9,009
  4. Avatar for ViJay7019 74. ViJay7019 Lv 1 8 pts. 9,000
  5. Avatar for Simek 75. Simek Lv 1 8 pts. 9,000
  6. Avatar for Merf 76. Merf Lv 1 8 pts. 8,965
  7. Avatar for alcor29 77. alcor29 Lv 1 7 pts. 8,955
  8. Avatar for Perzik 78. Perzik Lv 1 7 pts. 8,924
  9. Avatar for Festering Wounds 79. Festering Wounds Lv 1 7 pts. 8,894
  10. Avatar for deLaCeiba 80. deLaCeiba Lv 1 6 pts. 8,880

Comments