Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,472
  2. Avatar for Gargleblasters 2. Gargleblasters 83 pts. 9,436
  3. Avatar for Go Science 3. Go Science 68 pts. 9,429
  4. Avatar for Contenders 4. Contenders 55 pts. 9,425
  5. Avatar for Beta Folders 5. Beta Folders 44 pts. 9,257
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 9,155
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 8,989
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 21 pts. 8,880
  9. Avatar for Russian team 9. Russian team 16 pts. 8,734
  10. Avatar for Deleted group 10. Deleted group pts. 8,577

  1. Avatar for ZeroLeak7 11. ZeroLeak7 Lv 1 75 pts. 9,221
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 73 pts. 9,221
  3. Avatar for bertro 13. bertro Lv 1 71 pts. 9,203
  4. Avatar for Susume 14. Susume Lv 1 69 pts. 9,200
  5. Avatar for eusair 15. eusair Lv 1 67 pts. 9,172
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 65 pts. 9,155
  7. Avatar for johnmitch 17. johnmitch Lv 1 63 pts. 9,136
  8. Avatar for LociOiling 18. LociOiling Lv 1 61 pts. 9,124
  9. Avatar for caglar 19. caglar Lv 1 59 pts. 9,058
  10. Avatar for crpainter 20. crpainter Lv 1 57 pts. 9,048

Comments