Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,472
  2. Avatar for Gargleblasters 2. Gargleblasters 83 pts. 9,436
  3. Avatar for Go Science 3. Go Science 68 pts. 9,429
  4. Avatar for Contenders 4. Contenders 55 pts. 9,425
  5. Avatar for Beta Folders 5. Beta Folders 44 pts. 9,257
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 9,155
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 8,989
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 21 pts. 8,880
  9. Avatar for Russian team 9. Russian team 16 pts. 8,734
  10. Avatar for Deleted group 10. Deleted group pts. 8,577
  1. Avatar for harvardman 51. harvardman Lv 1 19 pts. 8,602
  2. Avatar for randomlil 52. randomlil Lv 1 19 pts. 8,590
  3. Avatar for alwen 53. alwen Lv 1 18 pts. 8,585
  4. Avatar for drumpeter18yrs9yrs 54. drumpeter18yrs9yrs Lv 1 17 pts. 8,577
  5. Avatar for reefyrob 55. reefyrob Lv 1 17 pts. 8,558
  6. Avatar for Merf 56. Merf Lv 1 16 pts. 8,558
  7. Avatar for phi16 57. phi16 Lv 1 15 pts. 8,548
  8. Avatar for severin333 58. severin333 Lv 1 15 pts. 8,543
  9. Avatar for manu8170 59. manu8170 Lv 1 14 pts. 8,542
  10. Avatar for Vinara 60. Vinara Lv 1 13 pts. 8,540

Comments