Placeholder image of a protein
Icon representing a puzzle

1360: Unsolved De-novo Freestyle 103

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PYAILSHTWGPDEEEVSYKDLKDGRAVSKLGYNKIRFCADQAWRDGRKFFWVDTCCIDKSNSTELQEAINSMFRWYRDAAKCYVYLTDVSTDKRDADGDPSWKWAFQKCKWFTRGWTLQE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,472
  2. Avatar for Gargleblasters 2. Gargleblasters 83 pts. 9,436
  3. Avatar for Go Science 3. Go Science 68 pts. 9,429
  4. Avatar for Contenders 4. Contenders 55 pts. 9,425
  5. Avatar for Beta Folders 5. Beta Folders 44 pts. 9,257
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 9,155
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 8,989
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 21 pts. 8,880
  9. Avatar for Russian team 9. Russian team 16 pts. 8,734
  10. Avatar for Deleted group 10. Deleted group pts. 8,577
  1. Avatar for Mike Cassidy 31. Mike Cassidy Lv 1 40 pts. 8,847
  2. Avatar for Keresto 32. Keresto Lv 1 38 pts. 8,842
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 37 pts. 8,817
  4. Avatar for fiendish_ghoul 34. fiendish_ghoul Lv 1 36 pts. 8,807
  5. Avatar for tarimo 35. tarimo Lv 1 35 pts. 8,805
  6. Avatar for katling 36. katling Lv 1 34 pts. 8,798
  7. Avatar for TastyMunchies 37. TastyMunchies Lv 1 32 pts. 8,769
  8. Avatar for jobo0502 38. jobo0502 Lv 1 31 pts. 8,769
  9. Avatar for tony46 39. tony46 Lv 1 30 pts. 8,758
  10. Avatar for ralan-nsk 40. ralan-nsk Lv 1 29 pts. 8,734

Comments