Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,557
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,536
  3. Avatar for Go Science 3. Go Science 58 pts. 9,534
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,490
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,486
  6. Avatar for Contenders 6. Contenders 22 pts. 9,455
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,440
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,412
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,269
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,268
  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 40 pts. 9,330
  2. Avatar for smilingone 32. smilingone Lv 1 39 pts. 9,328
  3. Avatar for NinjaGreg 33. NinjaGreg Lv 1 37 pts. 9,323
  4. Avatar for jermainiac 34. jermainiac Lv 1 36 pts. 9,302
  5. Avatar for pvc78 35. pvc78 Lv 1 35 pts. 9,300
  6. Avatar for katling 36. katling Lv 1 34 pts. 9,288
  7. Avatar for joremen 37. joremen Lv 1 33 pts. 9,284
  8. Avatar for crpainter 38. crpainter Lv 1 31 pts. 9,274
  9. Avatar for Mr_Jolty 39. Mr_Jolty Lv 1 30 pts. 9,269
  10. Avatar for manu8170 40. manu8170 Lv 1 29 pts. 9,269

Comments