Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 8,763
  2. Avatar for xkcd 12. xkcd 2 pts. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,486
  4. Avatar for Jayisgames 14. Jayisgames 1 pt. 8,316
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 7,926
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,808
  7. Avatar for BioChem22017 17. BioChem22017 1 pt. 7,447
  8. Avatar for SHELL 18. SHELL 1 pt. 3,210
  9. Avatar for D001x Med Chem MOOC 19. D001x Med Chem MOOC 1 pt. 3,210
  10. Avatar for Window Group 20. Window Group 1 pt. 3,210
  1. Avatar for benrh 111. benrh Lv 1 1 pt. 8,325
  2. Avatar for navn 112. navn Lv 1 1 pt. 8,325
  3. Avatar for vincethec 113. vincethec Lv 1 1 pt. 8,316
  4. Avatar for Rackera 114. Rackera Lv 1 1 pt. 8,305
  5. Avatar for Hollinas 115. Hollinas Lv 1 1 pt. 8,294
  6. Avatar for leehaggis 116. leehaggis Lv 1 1 pt. 8,236
  7. Avatar for marclacroix 117. marclacroix Lv 1 1 pt. 8,235
  8. Avatar for DScott 118. DScott Lv 1 1 pt. 8,232
  9. Avatar for WalkerP 119. WalkerP Lv 1 1 pt. 8,230
  10. Avatar for trentis1 120. trentis1 Lv 1 1 pt. 8,228

Comments