Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 8,763
  2. Avatar for xkcd 12. xkcd 2 pts. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,486
  4. Avatar for Jayisgames 14. Jayisgames 1 pt. 8,316
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 7,926
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,808
  7. Avatar for BioChem22017 17. BioChem22017 1 pt. 7,447
  8. Avatar for SHELL 18. SHELL 1 pt. 3,210
  9. Avatar for D001x Med Chem MOOC 19. D001x Med Chem MOOC 1 pt. 3,210
  10. Avatar for Window Group 20. Window Group 1 pt. 3,210
  1. Avatar for MeZzo 161. MeZzo Lv 1 1 pt. 7,729
  2. Avatar for pielie 162. pielie Lv 1 1 pt. 7,708
  3. Avatar for 01010011111 163. 01010011111 Lv 1 1 pt. 7,544
  4. Avatar for Ebony Missick 164. Ebony Missick Lv 1 1 pt. 7,447
  5. Avatar for straydog_1212 165. straydog_1212 Lv 1 1 pt. 7,229
  6. Avatar for MyTI 166. MyTI Lv 1 1 pt. 7,140
  7. Avatar for BobbyD 167. BobbyD Lv 1 1 pt. 3,210
  8. Avatar for D001x_ErlandStevens 168. D001x_ErlandStevens Lv 1 1 pt. 3,210
  9. Avatar for jflat06 169. jflat06 Lv 1 1 pt. 3,210
  10. Avatar for RAH 170. RAH Lv 1 1 pt. 3,210

Comments