Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Russian team 11. Russian team 3 pts. 8,763
  2. Avatar for xkcd 12. xkcd 2 pts. 8,590
  3. Avatar for Jayisgames 14. Jayisgames 1 pt. 8,316
  4. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,808
  5. Avatar for BioChem22017 17. BioChem22017 1 pt. 7,447
  6. Avatar for SHELL 18. SHELL 1 pt. 3,210
  7. Avatar for D001x Med Chem MOOC 19. D001x Med Chem MOOC 1 pt. 3,210
  8. Avatar for Window Group 20. Window Group 1 pt. 3,210

  1. Avatar for jobo0502 51. jobo0502 Lv 1 20 pts. 9,216
  2. Avatar for dbuske 52. dbuske Lv 1 19 pts. 9,194
  3. Avatar for diamonddays 53. diamonddays Lv 1 18 pts. 9,191
  4. Avatar for caglar 54. caglar Lv 1 17 pts. 9,188
  5. Avatar for alwen 55. alwen Lv 1 17 pts. 9,171
  6. Avatar for Anfinsen_slept_here 56. Anfinsen_slept_here Lv 1 16 pts. 9,162
  7. Avatar for Mydogisa Toelicker 57. Mydogisa Toelicker Lv 1 15 pts. 9,159
  8. Avatar for hansvandenhof 58. hansvandenhof Lv 1 15 pts. 9,152
  9. Avatar for MicElephant 59. MicElephant Lv 1 14 pts. 9,148
  10. Avatar for Vinara 60. Vinara Lv 1 14 pts. 9,144

Comments