Placeholder image of a protein
Icon representing a puzzle

1368: Revisiting Puzzle 96: Collagen

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Void Crushers 100 pts. 9,557
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,536
  3. Avatar for Go Science 3. Go Science 58 pts. 9,534
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,490
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,486
  6. Avatar for Contenders 6. Contenders 22 pts. 9,455
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,440
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 9,412
  9. Avatar for Natural Abilities 9. Natural Abilities 7 pts. 9,269
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,268

  1. Avatar for jobo0502 51. jobo0502 Lv 1 20 pts. 9,216
  2. Avatar for dbuske 52. dbuske Lv 1 19 pts. 9,194
  3. Avatar for diamonddays 53. diamonddays Lv 1 18 pts. 9,191
  4. Avatar for caglar 54. caglar Lv 1 17 pts. 9,188
  5. Avatar for alwen 55. alwen Lv 1 17 pts. 9,171
  6. Avatar for Anfinsen_slept_here 56. Anfinsen_slept_here Lv 1 16 pts. 9,162
  7. Avatar for Mydogisa Toelicker 57. Mydogisa Toelicker Lv 1 15 pts. 9,159
  8. Avatar for hansvandenhof 58. hansvandenhof Lv 1 15 pts. 9,152
  9. Avatar for MicElephant 59. MicElephant Lv 1 14 pts. 9,148
  10. Avatar for Vinara 60. Vinara Lv 1 14 pts. 9,144

Comments