Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,401
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,743
  3. Avatar for xkcd 13. xkcd 1 pt. 8,671
  4. Avatar for Window Group 14. Window Group 1 pt. 8,188
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 8,145
  6. Avatar for BioChem22017 16. BioChem22017 1 pt. 8,078
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,663
  1. Avatar for tarimo 21. tarimo Lv 1 50 pts. 9,843
  2. Avatar for Aubade01 22. Aubade01 Lv 1 48 pts. 9,842
  3. Avatar for jermainiac 23. jermainiac Lv 1 47 pts. 9,841
  4. Avatar for actiasluna 24. actiasluna Lv 1 45 pts. 9,837
  5. Avatar for Deleted player 25. Deleted player pts. 9,836
  6. Avatar for nicobul 26. nicobul Lv 1 41 pts. 9,823
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 40 pts. 9,823
  8. Avatar for isaksson 28. isaksson Lv 1 38 pts. 9,820
  9. Avatar for Deleted player 29. Deleted player pts. 9,815
  10. Avatar for jobo0502 30. jobo0502 Lv 1 35 pts. 9,810

Comments