Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 73 pts. 9,942
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,940
  4. Avatar for Contenders 4. Contenders 36 pts. 9,935
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 9,926
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,869
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,859
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,823
  9. Avatar for Russian team 9. Russian team 4 pts. 9,733
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,503
  1. Avatar for tarimo 21. tarimo Lv 1 50 pts. 9,843
  2. Avatar for Aubade01 22. Aubade01 Lv 1 48 pts. 9,842
  3. Avatar for jermainiac 23. jermainiac Lv 1 47 pts. 9,841
  4. Avatar for actiasluna 24. actiasluna Lv 1 45 pts. 9,837
  5. Avatar for Deleted player 25. Deleted player pts. 9,836
  6. Avatar for nicobul 26. nicobul Lv 1 41 pts. 9,823
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 40 pts. 9,823
  8. Avatar for isaksson 28. isaksson Lv 1 38 pts. 9,820
  9. Avatar for Deleted player 29. Deleted player pts. 9,815
  10. Avatar for jobo0502 30. jobo0502 Lv 1 35 pts. 9,810

Comments