Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,401
  2. Avatar for xkcd 13. xkcd 1 pt. 8,671
  3. Avatar for Window Group 14. Window Group 1 pt. 8,188
  4. Avatar for BioChem22017 16. BioChem22017 1 pt. 8,078
  5. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,663

  1. Avatar for bcre8tvv 51. bcre8tvv Lv 1 14 pts. 9,662
  2. Avatar for WBarme1234 52. WBarme1234 Lv 1 14 pts. 9,662
  3. Avatar for pvc78 53. pvc78 Lv 1 13 pts. 9,662
  4. Avatar for Flagg65a 54. Flagg65a Lv 1 12 pts. 9,649
  5. Avatar for guineapig 55. guineapig Lv 1 12 pts. 9,645
  6. Avatar for Anfinsen_slept_here 56. Anfinsen_slept_here Lv 1 11 pts. 9,643
  7. Avatar for manu8170 57. manu8170 Lv 1 11 pts. 9,640
  8. Avatar for Skippysk8s 58. Skippysk8s Lv 1 10 pts. 9,634
  9. Avatar for caglar 59. caglar Lv 1 10 pts. 9,627
  10. Avatar for georg137 60. georg137 Lv 1 9 pts. 9,625

Comments